Lineage for d1od7a_ (1od7 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741827Protein N-terminal domain of sialoadhesin [48732] (1 species)
  7. 2741828Species Mouse (Mus musculus) [TaxId:10090] [48733] (6 PDB entries)
    Uniprot Q62230 20-130
  8. 2741835Domain d1od7a_: 1od7 A: [86837]
    complexed with suw

Details for d1od7a_

PDB Entry: 1od7 (more details), 3 Å

PDB Description: n-terminal of sialoadhesin in complex with me-a-9-n-(naphthyl-2-carbonyl)-amino-9-deoxy-neu5ac (nap compound)
PDB Compounds: (A:) sialoadhesin

SCOPe Domain Sequences for d1od7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1od7a_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]}
twgvsspknvqglsgscllipcifsypadvpvsngitaiwyydysgkrqvvihsgdpklv
dkrfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeisdsnrwldvkgttvtvttd

SCOPe Domain Coordinates for d1od7a_:

Click to download the PDB-style file with coordinates for d1od7a_.
(The format of our PDB-style files is described here.)

Timeline for d1od7a_: