Lineage for d1od6a_ (1od6 A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 392101Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 392102Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 392250Family c.26.1.3: Adenylyltransferase [52397] (5 proteins)
  6. 392328Protein Phosphopantetheine adenylyltransferase [52398] (3 species)
  7. 392340Species Thermus thermophilus [TaxId:274] [89612] (1 PDB entry)
  8. 392341Domain d1od6a_: 1od6 A: [86836]
    complexed with pns, so4

Details for d1od6a_

PDB Entry: 1od6 (more details), 1.5 Å

PDB Description: the crystal structure of phosphopantetheine adenylyltransferase from thermus thermophilus in complex with 4'-phosphopantetheine

SCOP Domain Sequences for d1od6a_:

Sequence, based on SEQRES records: (download)

>d1od6a_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Thermus thermophilus}
mhvvypgsfdpltnghldviqrasrlfekvtvavlenpskrgqylfsaeerlaiireata
hlanveaatfsgllvdfvrrvgaqaivkglravsdyeyelqmahlnrqlypgletlfila
atrysfvsstmvkeiaryggdvsklvppatlralkaklgq

Sequence, based on observed residues (ATOM records): (download)

>d1od6a_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Thermus thermophilus}
mhvvypgsfdpltnghldviqrasrlfekvtvavlenqylfsaeerlaiireatahlanv
eaatfsgllvdfvrrvgaqaivkglravsdyeyelqmahlnrqlypgletlfilaatrys
fvsstmvkeiaryggdvsklvppatlralkaklgq

SCOP Domain Coordinates for d1od6a_:

Click to download the PDB-style file with coordinates for d1od6a_.
(The format of our PDB-style files is described here.)

Timeline for d1od6a_: