Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.3: Adenylyltransferase [52397] (6 proteins) |
Protein Phosphopantetheine adenylyltransferase [52398] (7 species) |
Species Thermus thermophilus [TaxId:274] [89612] (1 PDB entry) |
Domain d1od6a_: 1od6 A: [86836] complexed with pns, so4 |
PDB Entry: 1od6 (more details), 1.5 Å
SCOPe Domain Sequences for d1od6a_:
Sequence, based on SEQRES records: (download)
>d1od6a_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Thermus thermophilus [TaxId: 274]} mhvvypgsfdpltnghldviqrasrlfekvtvavlenpskrgqylfsaeerlaiireata hlanveaatfsgllvdfvrrvgaqaivkglravsdyeyelqmahlnrqlypgletlfila atrysfvsstmvkeiaryggdvsklvppatlralkaklgq
>d1od6a_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Thermus thermophilus [TaxId: 274]} mhvvypgsfdpltnghldviqrasrlfekvtvavlenqylfsaeerlaiireatahlanv eaatfsgllvdfvrrvgaqaivkglravsdyeyelqmahlnrqlypgletlfilaatrys fvsstmvkeiaryggdvsklvppatlralkaklgq
Timeline for d1od6a_: