Lineage for d1od6a_ (1od6 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860373Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 2860491Protein Phosphopantetheine adenylyltransferase [52398] (7 species)
  7. 2860568Species Thermus thermophilus [TaxId:274] [89612] (1 PDB entry)
  8. 2860569Domain d1od6a_: 1od6 A: [86836]
    complexed with pns, so4

Details for d1od6a_

PDB Entry: 1od6 (more details), 1.5 Å

PDB Description: the crystal structure of phosphopantetheine adenylyltransferase from thermus thermophilus in complex with 4'-phosphopantetheine
PDB Compounds: (A:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d1od6a_:

Sequence, based on SEQRES records: (download)

>d1od6a_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Thermus thermophilus [TaxId: 274]}
mhvvypgsfdpltnghldviqrasrlfekvtvavlenpskrgqylfsaeerlaiireata
hlanveaatfsgllvdfvrrvgaqaivkglravsdyeyelqmahlnrqlypgletlfila
atrysfvsstmvkeiaryggdvsklvppatlralkaklgq

Sequence, based on observed residues (ATOM records): (download)

>d1od6a_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Thermus thermophilus [TaxId: 274]}
mhvvypgsfdpltnghldviqrasrlfekvtvavlenqylfsaeerlaiireatahlanv
eaatfsgllvdfvrrvgaqaivkglravsdyeyelqmahlnrqlypgletlfilaatrys
fvsstmvkeiaryggdvsklvppatlralkaklgq

SCOPe Domain Coordinates for d1od6a_:

Click to download the PDB-style file with coordinates for d1od6a_.
(The format of our PDB-style files is described here.)

Timeline for d1od6a_: