Lineage for d1od5a1 (1od5 A:7-251)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2080272Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2080350Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins)
  6. 2080374Protein Seed storage 7S protein [51188] (6 species)
    duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer
  7. 2080441Species Soybean (Glycine max), glycinin A3B4 [TaxId:3847] [89412] (1 PDB entry)
  8. 2080442Domain d1od5a1: 1od5 A:7-251 [86832]
    complexed with co3, mg

Details for d1od5a1

PDB Entry: 1od5 (more details), 2.1 Å

PDB Description: crystal structure of glycinin a3b4 subunit homohexamer
PDB Compounds: (A:) glycinin

SCOPe Domain Sequences for d1od5a1:

Sequence, based on SEQRES records: (download)

>d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]}
necqlnnlnalepdhrvesegglietwnsqhpelqcagvtvskrtlnrnglhlpsyspyp
qmiivvqgkgaigfafpgcpetfekpqqqssrrgsrsqqqlqdshqkirhfnegdvlvip
pgvpywtyntgdepvvaislldtsnfnnqldqnprvfylagnpdiehpetmqqqqqqksh
ggrkqgqhqqqeeeggsvlsgfskhflaqsfntnedtaeklrspdderkqivtvegglsv
ispkw

Sequence, based on observed residues (ATOM records): (download)

>d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]}
necqlnnlnalepdhrvesegglietwnsqhpelqcagvtvskrtlnrnglhlpsyspyp
qmiivvqgkgaigfafpgcpetfekpqdshqkirhfnegdvlvippgvpywtyntgdepv
vaislldtsnfnnqldqnprvfylagnpdiehpetmqeggsvlsgfskhflaqsfntned
taeklrspdderkqivtvegglsvispkw

SCOPe Domain Coordinates for d1od5a1:

Click to download the PDB-style file with coordinates for d1od5a1.
(The format of our PDB-style files is described here.)

Timeline for d1od5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1od5a2