Class b: All beta proteins [48724] (141 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (12 families) |
Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins) |
Protein Seed storage 7S protein [51188] (5 species) duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer |
Species Soybean (Glycine max), glycinin A3B4 [TaxId:3847] [89412] (1 PDB entry) |
Domain d1od5a1: 1od5 A:7-251 [86832] |
PDB Entry: 1od5 (more details), 2.1 Å
SCOP Domain Sequences for d1od5a1:
Sequence, based on SEQRES records: (download)
>d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4} necqlnnlnalepdhrvesegglietwnsqhpelqcagvtvskrtlnrnglhlpsyspyp qmiivvqgkgaigfafpgcpetfekpqqqssrrgsrsqqqlqdshqkirhfnegdvlvip pgvpywtyntgdepvvaislldtsnfnnqldqnprvfylagnpdiehpetmqqqqqqksh ggrkqgqhqqqeeeggsvlsgfskhflaqsfntnedtaeklrspdderkqivtvegglsv ispkw
>d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4} necqlnnlnalepdhrvesegglietwnsqhpelqcagvtvskrtlnrnglhlpsyspyp qmiivvqgkgaigfafpgcpetfekpqdshqkirhfnegdvlvippgvpywtyntgdepv vaislldtsnfnnqldqnprvfylagnpdiehpetmqeggsvlsgfskhflaqsfntned taeklrspdderkqivtvegglsvispkw
Timeline for d1od5a1: