Lineage for d1od4c2 (1od4 C:1815-2196)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2099797Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (7 protein domains)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 2099798Protein Acetyl-coenzyme A carboxylase [89573] (1 species)
    duplication: consists of two similar structural domains forming a functional domain of a larger multifunctional enzyme
  7. 2099799Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89574] (8 PDB entries)
    Uniprot Q00955 1482-2196
  8. 2099839Domain d1od4c2: 1od4 C:1815-2196 [86831]
    complexed with ade

Details for d1od4c2

PDB Entry: 1od4 (more details), 2.7 Å

PDB Description: acetyl-coa carboxylase carboxyltransferase domain
PDB Compounds: (C:) acetyl-coenzyme a carboxylase

SCOPe Domain Sequences for d1od4c2:

Sequence, based on SEQRES records: (download)

>d1od4c2 c.14.1.4 (C:1815-2196) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nmpvpiletkdtwdrpvdftptndetydvrwmiegretesgfeyglfdkgsffetlsgwa
kgvvvgrarlggiplgvigvetrtvenlipadpanpnsaetliqepgqvwhpnsafktaq
aindfnngeqlpmmilanwrgfsggqrdmfnevlkygsfivdalvdykqpiiiyipptge
lrggswvvvdptinadqmemyadvnaragvlepqgmvgikfrreklldtmnrlddkyrel
rsqlsnkslapevhqqiskqladrerellpiygqislqfadlhdrssrmvakgviskele
wtearrfffwrlrrrlneeylikrlshqvgeasrlekiarirswypasvdheddrqvatw
ieenyktlddklkglklesfaq

Sequence, based on observed residues (ATOM records): (download)

>d1od4c2 c.14.1.4 (C:1815-2196) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nmpvpiletkdtwdrpvdftptndetydvrwmiegretesgfeyglfdkgsffetlsgwa
kgvvvgrarlggiplgvigvetrtvenlipadpanpnsaetliqepgqvwhpnsafktaq
aindfnngeqlpmmilanwrgfsggqrdmfnevlkygsfivdalvdykqpiiiyipptge
lrggswvvvdptinadqmemyadvnaragvlepqgmvgikfrreklldtmnrlellpiyg
qislqfadlhdrssrmvakgviskelewtearrfffwrlrrrlneeylikrlshqvgeas
rlekiarirswypasvdheddrqvatwieenyktlddklkglklesfaq

SCOPe Domain Coordinates for d1od4c2:

Click to download the PDB-style file with coordinates for d1od4c2.
(The format of our PDB-style files is described here.)

Timeline for d1od4c2: