SCOPe 2.07: Domain d1od4c1: 1od4 C:1492-1814

Lineage for d1od4c1 (1od4 C:1492-1814)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (7 proteins)
   Pfam PF01039
   the active site is formed by two different homologous subunits or domains of this fold

6. Protein Acetyl-coenzyme A carboxylase [89573] (1 species)
   duplication: consists of two similar structural domains forming a functional domain of a larger multifunctional enzyme

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89574] (8 PDB entries)
   Uniprot Q00955 1482-2196

8. Domain d1od4c1: 1od4 C:1492-1814 [86830]
   complexed with ade

Details for d1od4c1

PDB Entry: 1od4, 2.7 Å

PDB Description: acetyl-coa carboxylase carboxyltransferase domain

PDB Compounds: (C:) acetyl-coenzyme a carboxylase

SCOPe Domain Sequences for d1od4c1:

Sequence; same for both SEQRES and ATOM records:

>d1od4c1 c.14.1.4 (C:1492-1814) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
wlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisneliedengelt
everepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqedeffnkvteya
rkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltsegmetlkkfdk
ensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhdiftitlvtcr
svgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtqimynngvshl
tavddlagvekivewmsyvpakr

Timeline for d1od4c1:

• d1od4c1 first appeared in SCOP 1.65
  
• d1od4c1 appears in SCOPe 2.06
  
• d1od4c1 appears in the current release, SCOPe 2.08