SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1od4a2 (1od4 A:1815-2196)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2099797Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (7 protein domains)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 2099798Protein Acetyl-coenzyme A carboxylase [89573] (1 species)
    duplication: consists of two similar structural domains forming a functional domain of a larger multifunctional enzyme
  7. 2099799Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89574] (8 PDB entries)
    Uniprot Q00955 1482-2196
  8. 2099835Domain d1od4a2: 1od4 A:1815-2196 [86827]
    complexed with ade

Details for d1od4a2

PDB Entry: 1od4 (more details), 2.7 Å

PDB Description: acetyl-coa carboxylase carboxyltransferase domain
PDB Compounds: (A:) acetyl-coenzyme a carboxylase

SCOPe Domain Sequences for d1od4a2:

Sequence, based on SEQRES records: (download)

>d1od4a2 c.14.1.4 (A:1815-2196) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nmpvpiletkdtwdrpvdftptndetydvrwmiegretesgfeyglfdkgsffetlsgwa
kgvvvgrarlggiplgvigvetrtvenlipadpanpnsaetliqepgqvwhpnsafktaq
aindfnngeqlpmmilanwrgfsggqrdmfnevlkygsfivdalvdykqpiiiyipptge
lrggswvvvdptinadqmemyadvnaragvlepqgmvgikfrreklldtmnrlddkyrel
rsqlsnkslapevhqqiskqladrerellpiygqislqfadlhdrssrmvakgviskele
wtearrfffwrlrrrlneeylikrlshqvgeasrlekiarirswypasvdheddrqvatw
ieenyktlddklkglklesfaq

Sequence, based on observed residues (ATOM records): (download)

>d1od4a2 c.14.1.4 (A:1815-2196) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nmpvpiletkdtwdrpvdftptndetydvrwmiegretesgfeyglfdkgsffetlsgwa
kgvvvgrarlggiplgvigvetrtvenlipadpanpnsaetliqepgqvwhpnsafktaq
aindfnngeqlpmmilanwrgfsggqrdmfnevlkygsfivdalvdykqpiiiyipptge
lrggswvvvdptinadqmemyadvnaragvlepqgmvgikfrreklldtmnrlellpiyg
qislqfadlhdrssrmvakgviskelewtearrfffwrlrrrlneeylikrlshqvgeas
rlekiarirswypasvdheddrqvatwieenyktlddklkglklesfaq

SCOPe Domain Coordinates for d1od4a2:

Click to download the PDB-style file with coordinates for d1od4a2.
(The format of our PDB-style files is described here.)

Timeline for d1od4a2: