SCOP 1.67: Domain d1od4a1: 1od4 A:1480-1814

Lineage for d1od4a1 (1od4 A:1480-1814)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (4 families)

5. Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (3 proteins)
   the active site is formed by two different homologous subunits or domains of this fold

6. Protein Acetyl-coenzyme A carboxylase [89573] (1 species)
   duplication: consists of two similar structural domains forming a functional domain of a larger multifunctional enzyme

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89574] (6 PDB entries)

8. Domain d1od4a1: 1od4 A:1480-1814 [86826]

Details for d1od4a1

PDB Entry: 1od4, 2.7 Å

PDB Description: acetyl-coa carboxylase carboxyltransferase domain

SCOP Domain Sequences for d1od4a1:

Sequence; same for both SEQRES and ATOM records:

>d1od4a1 c.14.1.4 (A:1480-1814) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae)}
lrpiatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffis
neliedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpq
edeffnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylylt
segmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsray
hdiftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlgg
tqimynngvshltavddlagvekivewmsyvpakr

Timeline for d1od4a1:

• d1od4a1 first appeared in SCOP 1.65
  
• d1od4a1 appears in SCOP 1.69
  
• d1od4a1 appears in the current release, SCOPe 2.08