Lineage for d1od3a_ (1od3 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2046279Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2046280Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2046679Family b.18.1.10: Family 6 carbohydrate binding module, CBM6 [69213] (4 proteins)
  6. 2046704Protein Putative xylanase [89239] (1 species)
  7. 2046705Species Clostridium stercorarium [TaxId:1510] [89240] (8 PDB entries)
    Uniprot P33558 243-374, 384-512
  8. 2046706Domain d1od3a_: 1od3 A: [86825]
    CBM6-3, in complex with laminaribiose
    complexed with acy, ca

Details for d1od3a_

PDB Entry: 1od3 (more details), 1 Å

PDB Description: structure of cscbm6-3 from clostridium stercorarium in complex with laminaribiose
PDB Compounds: (A:) putative xylanase

SCOPe Domain Sequences for d1od3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1od3a_ b.18.1.10 (A:) Putative xylanase {Clostridium stercorarium [TaxId: 1510]}
vggtrsafsniqaedydssygpnlqifslpgggsaigyiengysttyknidfgdgatsvt
arvatqnattiqvrlgspsgtllgtiyvgstgsfdtyrdvsatisntagvkdivlvfsgp
vnvdwfvfsksg

SCOPe Domain Coordinates for d1od3a_:

Click to download the PDB-style file with coordinates for d1od3a_.
(The format of our PDB-style files is described here.)

Timeline for d1od3a_: