![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (19 families) ![]() |
![]() | Family b.18.1.10: CBM6 [69213] (2 proteins) |
![]() | Protein Putative xylanase [89239] (1 species) |
![]() | Species Clostridium stercorarium [TaxId:1510] [89240] (4 PDB entries) |
![]() | Domain d1od3a_: 1od3 A: [86825] CBM6-3, in complex with laminaribiose complexed with acy, bgc, ca |
PDB Entry: 1od3 (more details), 1 Å
SCOP Domain Sequences for d1od3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1od3a_ b.18.1.10 (A:) Putative xylanase {Clostridium stercorarium} vggtrsafsniqaedydssygpnlqifslpgggsaigyiengysttyknidfgdgatsvt arvatqnattiqvrlgspsgtllgtiyvgstgsfdtyrdvsatisntagvkdivlvfsgp vnvdwfvfsksg
Timeline for d1od3a_: