![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (7 proteins) Pfam PF01039 the active site is formed by two different homologous subunits or domains of this fold |
![]() | Protein Acetyl-coenzyme A carboxylase [89573] (1 species) duplication: consists of two similar structural domains forming a functional domain of a larger multifunctional enzyme |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89574] (8 PDB entries) Uniprot Q00955 1482-2196 |
![]() | Domain d1od2b2: 1od2 B:1815-2190 [86824] complexed with aco, ade |
PDB Entry: 1od2 (more details), 2.7 Å
SCOPe Domain Sequences for d1od2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1od2b2 c.14.1.4 (B:1815-2190) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} nmpvpiletkdtwdrpvdftptndetydvrwmiegretesgfeyglfdkgsffetlsgwa kgvvvgrarlggiplgvigvetrtvenlipadpanpnsaetliqepgqvwhpnsafktaq aindfnngeqlpmmilanwrgfsggqrdmfnevlkygsfivdalvdykqpiiiyipptge lrggswvvvdptinadqmemyadvnaragvlepqgmvgikfrreklldtmnrlddkyrel rsqlsnkslapevhqqiskqladrerellpiygqislqfadlhdrssrmvakgviskele wtearrfffwrlrrrlneeylikrlshqvgeasrlekiarirswypasvdheddrqvatw ieenyktlddklkglk
Timeline for d1od2b2: