Lineage for d1od2a2 (1od2 A:1815-2203)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 310547Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 310548Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 310667Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (2 proteins)
    the active site is formed by two different homologous subunits or domains of this fold
  6. 310668Protein Acetyl-coenzyme A carboxylase [89573] (1 species)
    duplication: consists of two similar structural domains forming a functional domain of a larger multifunctional enzyme
  7. 310669Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89574] (2 PDB entries)
  8. 310671Domain d1od2a2: 1od2 A:1815-2203 [86822]

Details for d1od2a2

PDB Entry: 1od2 (more details), 2.7 Å

PDB Description: acetyl-coa carboxylase carboxyltransferase domain

SCOP Domain Sequences for d1od2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1od2a2 c.14.1.4 (A:1815-2203) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae)}
nmpvpiletkdtwdrpvdftptndetydvrwmiegretesgfeyglfdkgsffetlsgwa
kgvvvgrarlggiplgvigvetrtvenlipadpanpnsaetliqepgqvwhpnsafktaq
aindfnngeqlpmmilanwrgfsggqrdmfnevlkygsfivdalvdykqpiiiyipptge
lrggswvvvdptinadqmemyadvnaragvlepqgmvgikfrreklldtmnrlddkyrel
rsqlsnkslapevhqqiskqladrerellpiygqislqfadlhdrssrmvakgviskele
wtearrfffwrlrrrlneeylikrlshqvgeasrlekiarirswypasvdheddrqvatw
ieenyktlddklkglklesfaqdlakkir

SCOP Domain Coordinates for d1od2a2:

Click to download the PDB-style file with coordinates for d1od2a2.
(The format of our PDB-style files is described here.)

Timeline for d1od2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1od2a1