Lineage for d1od0a_ (1od0 A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 384382Superfamily c.1.8: (Trans)glycosidases [51445] (10 families) (S)
  5. 385071Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (4 proteins)
  6. 385081Protein Beta-glucosidase A [51528] (6 species)
  7. 385118Species Thermotoga maritima [TaxId:243274] [89475] (4 PDB entries)
  8. 385123Domain d1od0a_: 1od0 A: [86818]

Details for d1od0a_

PDB Entry: 1od0 (more details), 2.11 Å

PDB Description: family 1 b-glucosidase from thermotoga maritima

SCOP Domain Sequences for d1od0a_:

Sequence, based on SEQRES records: (download)

>d1od0a_ c.1.8.4 (A:) Beta-glucosidase A {Thermotoga maritima}
vkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk
edieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyhw
dlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvhap
gmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepasekeediravrfm
hqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvkf
dpdapakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvse
dgrvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdys
tqkrivkdsgywysnvvknngle

Sequence, based on observed residues (ATOM records): (download)

>d1od0a_ c.1.8.4 (A:) Beta-glucosidase A {Thermotoga maritima}
vkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk
edieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyhw
dlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvhap
gmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepaseravrfmhqfnn
yplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvkfdpakv
sfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvsedgrvhdqn
ridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdystqkrivkd
sgywysnvvknngle

SCOP Domain Coordinates for d1od0a_:

Click to download the PDB-style file with coordinates for d1od0a_.
(The format of our PDB-style files is described here.)

Timeline for d1od0a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1od0b_