Lineage for d1ocvb_ (1ocv B:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 326290Fold d.17: Cystatin-like [54402] (6 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 326465Superfamily d.17.4: NTF2-like [54427] (8 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 326538Family d.17.4.3: Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54434] (1 protein)
  6. 326539Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)
  7. 326540Species Comamonas testosteroni and Pseudomonas testosteroni [54436] (5 PDB entries)
  8. 326542Domain d1ocvb_: 1ocv B: [86811]

Details for d1ocvb_

PDB Entry: 1ocv (more details), 2 Å

PDB Description: the f116w mutant structure of ketosteroid isomerase from comamonas testosteroni

SCOP Domain Sequences for d1ocvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocvb_ d.17.4.3 (B:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni and Pseudomonas testosteroni}
mntpehmtavvqryvaalnagdldgivalfaddatvedpvgseprsgtaairefyanslk
lplaveltqevravaneaafafivsfeyqgrktvvapidhfrfngagkvvsmralwgekn
ihaga

SCOP Domain Coordinates for d1ocvb_:

Click to download the PDB-style file with coordinates for d1ocvb_.
(The format of our PDB-style files is described here.)

Timeline for d1ocvb_: