Lineage for d1ocmb_ (1ocm B:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 322910Fold c.117: Amidase signature (AS) enzymes [75303] (1 superfamily)
    possible duplication: the topologies of N- and C-terminal halves are similar; 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213549A867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 322911Superfamily c.117.1: Amidase signature (AS) enzymes [75304] (1 family) (S)
  5. 322912Family c.117.1.1: Amidase signature (AS) enzymes [75305] (3 protein domains)
  6. 322931Protein Malonamidase E2 [75306] (1 species)
  7. 322932Species Bradyrhizobium japonicum [TaxId:375] [75307] (3 PDB entries)
  8. 322936Domain d1ocmb_: 1ocm B: [86807]
    complexed with pop

Details for d1ocmb_

PDB Entry: 1ocm (more details), 1.9 Å

PDB Description: the crystal structure of malonamidase e2 covalently complexed with pyrophosphate from bradyrhizobium japonicum

SCOP Domain Sequences for d1ocmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocmb_ c.117.1.1 (B:) Malonamidase E2 {Bradyrhizobium japonicum}
misladlqrrietgelspnaaiaqshaaiearekevhafvrhdksaraqasgplrgiavg
ikdiidtanmptemgseiyrgwqprsdapvvmmlkragatiigkttttafasrdptatln
phntghspggsssgsaaavgagmiplalgtqtggsvirpaaycgtaaikpsfrmlptvgv
kcyswaldtvglfgaraedlargllamtgrsefsgivpakaprigvvrqefagavepaae
qglqaaikaaeragasvqaidlpeavheawrihpiiqdfeahralawefsehhdeiapml
rasldatvgltpkeydearrigrrgrrelgevfegvdvlltysapgtapakalastgdpr
ynrlwtlmgnpcvnvpvlkvgglpigvqviarfgndahalatawfledalak

SCOP Domain Coordinates for d1ocmb_:

Click to download the PDB-style file with coordinates for d1ocmb_.
(The format of our PDB-style files is described here.)

Timeline for d1ocmb_: