Lineage for d1ocja_ (1ocj A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097504Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2097505Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (2 families) (S)
  5. 2097506Family c.6.1.1: Glycosyl hydrolases family 6, cellulases [51990] (4 protein domains)
    Pfam PF01341
  6. 2097507Protein Cellobiohydrolase II (Cel6) [51993] (3 species)
  7. 2097508Species Humicola insolens, Cel6a [TaxId:34413] [51995] (9 PDB entries)
  8. 2097510Domain d1ocja_: 1ocj A: [86801]
    complexed with acy, bgc, ma3, mg, nag, sgc, ssg; mutant

Details for d1ocja_

PDB Entry: 1ocj (more details), 1.3 Å

PDB Description: mutant d416a of the cellobiohydrolase cel6a from humicola insolens in complex with a thiopentasaccharide at 1.3 angstrom resolution
PDB Compounds: (A:) cellobiohydrolase II

SCOPe Domain Sequences for d1ocja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocja_ c.6.1.1 (A:) Cellobiohydrolase II (Cel6) {Humicola insolens, Cel6a [TaxId: 34413]}
gnpfegvqlwannyyrsevhtlaipqitdpalraaasavaevpsfqwldrnvtvdtllvq
tlseireanqaganpqyaaqivvydlpdrdcaaaasngewaianngvnnykayinrirei
lisfsdvrtilviepdslanmvtnmnvpkcsgaastyreltiyalkqldlphvamymdag
hagwlgwpaniqpaaelfakiyedagkpravrglatnvanynawsvsspppytspnpnyd
ekhyieafrplleargfpaqfivdqgrsgkqptgqkewghwcnaigtgfgmrptantghq
yvdafvwvkpggecdgtsdttaaryayhcgledalkpapeagqwfneyfiqllrnanppf

SCOPe Domain Coordinates for d1ocja_:

Click to download the PDB-style file with coordinates for d1ocja_.
(The format of our PDB-style files is described here.)

Timeline for d1ocja_: