SCOP 1.65: Domain d1oc9a_: 1oc9 A:

Lineage for d1oc9a_ (1oc9 A:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (13 proteins)

6. Protein Tryparedoxin II [64062] (1 species)

7. Species Crithidia fasciculata [TaxId:5656] [64063] (6 PDB entries)

8. Domain d1oc9a_: 1oc9 A: [86797]

Details for d1oc9a_

PDB Entry: 1oc9, 2.35 Å

PDB Description: tryparedoxin ii from c.fasciculata solved by mr

SCOP Domain Sequences for d1oc9a_:

Sequence; same for both SEQRES and ATOM records:

>d1oc9a_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata}
hmsglkkffpystnvlkgaaadialpslagktvffyfsaswcppcraftpqlidfykaha
esknfevmliswdesaedfkdyyakmpwlalpfedrkgmeflttgfdvksiptlvgvead
sgniittqartmvvkdpeakdfpwpnveakk

Timeline for d1oc9a_:

• d1oc9a_ is new in SCOP 1.65
  
• d1oc9a_ appears in SCOP 1.67
  
• d1oc9a_ appears in the current release, SCOPe 2.08