SCOPe 2.07: Domain d1oc0b_: 1oc0 B:

Lineage for d1oc0b_ (1oc0 B:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.64: Somatomedin B domain [90187] (1 superfamily)
   disulfide-rich

4. Superfamily g.64.1: Somatomedin B domain [90188] (1 family)
   automatically mapped to Pfam PF01033

5. Family g.64.1.1: Somatomedin B domain [90189] (1 protein)

6. Protein Vitronectin [90190] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [90191] (6 PDB entries)
   Uniprot P04004 20-70

8. Domain d1oc0b_: 1oc0 B: [86791]
   Other proteins in same PDB: d1oc0a_

Details for d1oc0b_

PDB Entry: 1oc0, 2.28 Å

PDB Description: plasminogen activator inhibitor-1 complex with somatomedin b domain of vitronectin

PDB Compounds: (B:) Vitronectin

SCOPe Domain Sequences for d1oc0b_:

Sequence; same for both SEQRES and ATOM records:

>d1oc0b_ g.64.1.1 (B:) Vitronectin {Human (Homo sapiens) [TaxId: 9606]}
esckgrctegfnvdkkcqcdelcsyyqscctdytaec

Timeline for d1oc0b_:

• d1oc0b_ first appeared in SCOP 1.65
  
• d1oc0b_ appears in SCOPe 2.06
  
• d1oc0b_ appears in the current release, SCOPe 2.08