Lineage for d1oc0b_ (1oc0 B:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2264838Fold g.64: Somatomedin B domain [90187] (1 superfamily)
    disulfide-rich
  4. 2264839Superfamily g.64.1: Somatomedin B domain [90188] (1 family) (S)
    automatically mapped to Pfam PF01033
  5. 2264840Family g.64.1.1: Somatomedin B domain [90189] (1 protein)
  6. 2264841Protein Vitronectin [90190] (1 species)
  7. 2264842Species Human (Homo sapiens) [TaxId:9606] [90191] (6 PDB entries)
    Uniprot P04004 20-70
  8. 2264843Domain d1oc0b_: 1oc0 B: [86791]
    Other proteins in same PDB: d1oc0a_

Details for d1oc0b_

PDB Entry: 1oc0 (more details), 2.28 Å

PDB Description: plasminogen activator inhibitor-1 complex with somatomedin b domain of vitronectin
PDB Compounds: (B:) Vitronectin

SCOPe Domain Sequences for d1oc0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oc0b_ g.64.1.1 (B:) Vitronectin {Human (Homo sapiens) [TaxId: 9606]}
esckgrctegfnvdkkcqcdelcsyyqscctdytaec

SCOPe Domain Coordinates for d1oc0b_:

Click to download the PDB-style file with coordinates for d1oc0b_.
(The format of our PDB-style files is described here.)

Timeline for d1oc0b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1oc0a_