SCOPe 2.05: Domain d1obzb2: 1obz B:195-272

Lineage for d1obzb2 (1obz B:195-272)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Syntenin 1 [89311] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89312] (11 PDB entries)

8. Domain d1obzb2: 1obz B:195-272 [86789]
   tandem of two PDZ domains; complexed with an interleukin 5 receptor alpha peptide, chain P
   complexed with act

Details for d1obzb2

PDB Entry: 1obz, 1.69 Å

PDB Description: crystal structure of the complex of the pdz tandem of syntenin with an interleukin 5 receptor alpha peptide.

PDB Compounds: (B:) Syntenin 1

SCOPe Domain Sequences for d1obzb2:

Sequence; same for both SEQRES and ATOM records:

>d1obzb2 b.36.1.1 (B:195-272) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]}
fertitmhkdstghvgfifkngkitsivkdssaarnglltehniceingqnviglkdsqi
adilstsgtvvtitimpa

Timeline for d1obzb2:

• d1obzb2 first appeared in SCOP 1.65
  
• d1obzb2 appears in SCOPe 2.04
  
• d1obzb2 appears in SCOPe 2.06
  
• d1obzb2 appears in the current release, SCOPe 2.08