| Class b: All beta proteins [48724] (176 folds) |
| Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) ![]() peptide-binding domain |
| Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
| Protein Syntenin 1 [89311] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [89312] (11 PDB entries) |
| Domain d1obzb2: 1obz B:195-272 [86789] tandem of two PDZ domains; complexed with an interleukin 5 receptor alpha peptide, chain P complexed with act |
PDB Entry: 1obz (more details), 1.69 Å
SCOPe Domain Sequences for d1obzb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1obzb2 b.36.1.1 (B:195-272) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]}
fertitmhkdstghvgfifkngkitsivkdssaarnglltehniceingqnviglkdsqi
adilstsgtvvtitimpa
Timeline for d1obzb2: