Lineage for d1obyb_ (1oby B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1785878Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1785879Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1785880Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 1786118Protein Syntenin 1 [89311] (1 species)
  7. 1786119Species Human (Homo sapiens) [TaxId:9606] [89312] (11 PDB entries)
  8. 1786136Domain d1obyb_: 1oby B: [86785]
    second PDZ domain; complexed with an interleukin 5 receptor alpha peptide, chains P and Q
    complexed with so4

Details for d1obyb_

PDB Entry: 1oby (more details), 1.85 Å

PDB Description: crystal structure of the complex of pdz2 of syntenin with a syndecan-4 peptide.
PDB Compounds: (B:) Syntenin 1

SCOPe Domain Sequences for d1obyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1obyb_ b.36.1.1 (B:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]}
rtitmhkdstghvgfifkngkitsivkdssaarnglltehniceingqnviglkdsqiad
ilstsgtvvtitim

SCOPe Domain Coordinates for d1obyb_:

Click to download the PDB-style file with coordinates for d1obyb_.
(The format of our PDB-style files is described here.)

Timeline for d1obyb_: