SCOP 1.71: Domain d1obyb_: 1oby B:

Lineage for d1obyb_ (1oby B:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (4 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (35 proteins)
   Pfam 00595

6. Protein Syntenin 1 [89311] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89312] (6 PDB entries)

8. Domain d1obyb_: 1oby B: [86785]
   second PDZ domain; complexed with an interleukin 5 receptor alpha peptide, chains P and Q
   complexed with so4

Details for d1obyb_

PDB Entry: 1oby, 1.85 Å

PDB Description: crystal structure of the complex of pdz2 of syntenin with a syndecan-4 peptide.

SCOP Domain Sequences for d1obyb_:

Sequence; same for both SEQRES and ATOM records:

>d1obyb_ b.36.1.1 (B:) Syntenin 1 {Human (Homo sapiens)}
rtitmhkdstghvgfifkngkitsivkdssaarnglltehniceingqnviglkdsqiad
ilstsgtvvtitim

Timeline for d1obyb_:

• d1obyb_ first appeared in SCOP 1.65
  
• d1obyb_ appears in SCOP 1.69
  
• d1obyb_ appears in SCOP 1.73
  
• d1obyb_ appears in the current release, SCOPe 2.08