Lineage for d1obya_ (1oby A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 666573Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 666574Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
    peptide-binding domain
  5. 666575Family b.36.1.1: PDZ domain [50157] (46 proteins)
    Pfam PF00595
  6. 666781Protein Syntenin 1 [89311] (1 species)
  7. 666782Species Human (Homo sapiens) [TaxId:9606] [89312] (11 PDB entries)
  8. 666798Domain d1obya_: 1oby A: [86784]

Details for d1obya_

PDB Entry: 1oby (more details), 1.85 Å

PDB Description: crystal structure of the complex of pdz2 of syntenin with a syndecan-4 peptide.
PDB Compounds: (A:) Syntenin 1

SCOP Domain Sequences for d1obya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1obya_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]}
prtitmhkdstghvgfifkngkitsivkdssaarnglltehniceingqnviglkdsqia
dilstsgtvvtitim

SCOP Domain Coordinates for d1obya_:

Click to download the PDB-style file with coordinates for d1obya_.
(The format of our PDB-style files is described here.)

Timeline for d1obya_:

666798
d1obya_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1obyb_