Lineage for d1obxa_ (1obx A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1538457Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1538458Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1538459Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 1538697Protein Syntenin 1 [89311] (1 species)
  7. 1538698Species Human (Homo sapiens) [TaxId:9606] [89312] (11 PDB entries)
  8. 1538701Domain d1obxa_: 1obx A: [86783]
    second PDZ domain; complexed with an interleukin 5 receptor alpha peptide, chain B
    complexed with co, so4

Details for d1obxa_

PDB Entry: 1obx (more details), 1.35 Å

PDB Description: crystal structure of the complex of pdz2 of syntenin with an interleukin 5 receptor alpha peptide.
PDB Compounds: (A:) Syntenin 1

SCOPe Domain Sequences for d1obxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1obxa_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]}
rtitmhkdstghvgfifkngkitsivkdssaarnglltehniceingqnviglkdsqiad
ilstsgtvvtitim

SCOPe Domain Coordinates for d1obxa_:

Click to download the PDB-style file with coordinates for d1obxa_.
(The format of our PDB-style files is described here.)

Timeline for d1obxa_: