Class b: All beta proteins [48724] (165 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (4 families) peptide-binding domain |
Family b.36.1.1: PDZ domain [50157] (46 proteins) Pfam PF00595 |
Protein Syntenin 1 [89311] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89312] (11 PDB entries) |
Domain d1obxa_: 1obx A: [86783] second PDZ domain; complexed with an interleukin 5 receptor alpha peptide, chain B complexed with co, so4 |
PDB Entry: 1obx (more details), 1.35 Å
SCOP Domain Sequences for d1obxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1obxa_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} rtitmhkdstghvgfifkngkitsivkdssaarnglltehniceingqnviglkdsqiad ilstsgtvvtitim
Timeline for d1obxa_: