Lineage for d1obqb_ (1obq B:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 805867Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 805868Superfamily b.60.1: Lipocalins [50814] (9 families) (S)
    bind hydrophobic ligands in their interior
  5. 805869Family b.60.1.1: Retinol binding protein-like [50815] (21 proteins)
    barrel, closed; n=8, S=12, meander
  6. 805870Protein Alpha-crustacyanin [63807] (1 species)
  7. 805871Species European lobster (Homarus gammarus) [TaxId:6707] [63808] (7 PDB entries)
  8. 805881Domain d1obqb_: 1obq B: [86779]

Details for d1obqb_

PDB Entry: 1obq (more details), 1.85 Å

PDB Description: apocrustacyanin c1 crystals grown in space and earth using vapour diffusion geometry
PDB Compounds: (B:) crustacyanin c1 subunit

SCOP Domain Sequences for d1obqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1obqb_ b.60.1.1 (B:) Alpha-crustacyanin {European lobster (Homarus gammarus) [TaxId: 6707]}
kipdfvvpgkcasvdrnklwaeqtpnrnsyagvwyqfaltnnpyqliekcvrneysfdgk
qfviestgiaydgnllkrngklypnpfgephlsidyensfaaplviletdysnyaclysc
idynfgyhsdfsfifsrsanladqyvkkceaafkninvdttrfvktvqgsscpydtqktl

SCOP Domain Coordinates for d1obqb_:

Click to download the PDB-style file with coordinates for d1obqb_.
(The format of our PDB-style files is described here.)

Timeline for d1obqb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1obqa_