![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
![]() | Family c.23.5.1: Flavodoxin-related [52219] (6 proteins) binds FMN |
![]() | Protein Flavodoxin [52220] (9 species) |
![]() | Species Anabaena, pcc 7119 and 7120 [TaxId:1163] [52223] (8 PDB entries) |
![]() | Domain d1obob_: 1obo B: [86777] complexed with fmn, so4 |
PDB Entry: 1obo (more details), 1.2 Å
SCOPe Domain Sequences for d1obob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1obob_ c.23.5.1 (B:) Flavodoxin {Anabaena, pcc 7119 and 7120 [TaxId: 1163]} akkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptlnig elqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyw stdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl
Timeline for d1obob_: