Lineage for d1obob_ (1obo B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
    binds FMN
  6. Protein Flavodoxin [52220] (11 species)
  7. Species Anabaena, pcc 7119 and 7120 [TaxId:1163] [52223] (8 PDB entries)
  8. Domain d1obob_: 1obo B: [86777]
    complexed with fmn, so4

Details for d1obob_

PDB Entry: 1obo (more details), 1.2 Å

PDB Description: w57l flavodoxin from anabaena
PDB Compounds: (B:) flavodoxin

SCOPe Domain Sequences for d1obob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1obob_ c.23.5.1 (B:) Flavodoxin {Anabaena, pcc 7119 and 7120 [TaxId: 1163]}
akkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptlnig
elqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyw
stdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl

SCOPe Domain Coordinates for d1obob_ are not available.

Timeline for d1obob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1oboa_