SCOPe 2.08: Domain d1obob_: 1obo B:

Lineage for d1obob_ (1obo B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
   binds FMN

6. Protein Flavodoxin [52220] (11 species)

7. Species Anabaena, pcc 7119 and 7120 [TaxId:1163] [52223] (8 PDB entries)

8. Domain d1obob_: 1obo B: [86777]
   complexed with fmn, so4

Details for d1obob_

PDB Entry: 1obo, 1.2 Å

PDB Description: w57l flavodoxin from anabaena

PDB Compounds: (B:) flavodoxin

SCOPe Domain Sequences for d1obob_:

Sequence; same for both SEQRES and ATOM records:

>d1obob_ c.23.5.1 (B:) Flavodoxin {Anabaena, pcc 7119 and 7120 [TaxId: 1163]}
akkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptlnig
elqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyw
stdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl

Timeline for d1obob_:

• d1obob_ first appeared in SCOP 1.65
  
• d1obob_ appears in SCOPe 2.07