Lineage for d1oboa_ (1obo A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 390873Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 391125Superfamily c.23.5: Flavoproteins [52218] (6 families) (S)
  5. 391126Family c.23.5.1: Flavodoxin-related [52219] (3 proteins)
    binds FMN
  6. 391127Protein Flavodoxin [52220] (7 species)
  7. 391128Species Anabaena, pcc 7119 and 7120 [TaxId:1163] [52223] (7 PDB entries)
  8. 391129Domain d1oboa_: 1obo A: [86776]

Details for d1oboa_

PDB Entry: 1obo (more details), 1.2 Å

PDB Description: w57l flavodoxin from anabaena

SCOP Domain Sequences for d1oboa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oboa_ c.23.5.1 (A:) Flavodoxin {Anabaena, pcc 7119 and 7120}
akkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptlnig
elqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyw
stdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl

SCOP Domain Coordinates for d1oboa_:

Click to download the PDB-style file with coordinates for d1oboa_.
(The format of our PDB-style files is described here.)

Timeline for d1oboa_: