![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
![]() | Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) ![]() |
![]() | Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins) |
![]() | Protein Leucyl-tRNA synthetase (LeuRS) [81746] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [81747] (3 PDB entries) |
![]() | Domain d1obha1: 1obh A:687-814 [86773] Other proteins in same PDB: d1obha2, d1obha3 The C-terminal region (residues 815-878) is invisible in the electron density protein/RNA complex; complexed with hg, lms, nva, so4 |
PDB Entry: 1obh (more details), 2.2 Å
SCOPe Domain Sequences for d1obha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1obha1 a.27.1.1 (A:687-814) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus [TaxId: 274]} flnriyrrvaedrealletsgvfqaealegkdrelygklhetlkkvtedlealrfntaia almeflnalyeyrkdrpvtpvyrtairyylqmlfpfaphlaeelwhwfwpdslfeagwpe ldekalek
Timeline for d1obha1: