Lineage for d1obha1 (1obh A:687-814)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 280298Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 280299Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (1 family) (S)
  5. 280300Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins)
  6. 280323Protein Leucyl-tRNA synthetase (LeuRS) [81746] (1 species)
  7. 280324Species Thermus thermophilus [TaxId:274] [81747] (3 PDB entries)
  8. 280327Domain d1obha1: 1obh A:687-814 [86773]
    Other proteins in same PDB: d1obha2, d1obha3
    The C-terminal region (residues 815-878) is invisible in the electron density
    complexed with hg, lms, nva, so4

Details for d1obha1

PDB Entry: 1obh (more details), 2.2 Å

PDB Description: leucyl-trna synthetase from thermus thermophilus complexed with a pre-transfer editing substrate analogue in both synthetic active site and editing site

SCOP Domain Sequences for d1obha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1obha1 a.27.1.1 (A:687-814) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus}
flnriyrrvaedrealletsgvfqaealegkdrelygklhetlkkvtedlealrfntaia
almeflnalyeyrkdrpvtpvyrtairyylqmlfpfaphlaeelwhwfwpdslfeagwpe
ldekalek

SCOP Domain Coordinates for d1obha1:

Click to download the PDB-style file with coordinates for d1obha1.
(The format of our PDB-style files is described here.)

Timeline for d1obha1: