SCOP 1.69: Domain d1obga_: 1obg A:

Lineage for d1obga_ (1obg A:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.143: SAICAR synthase-like [56103] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.143.1: SAICAR synthase-like [56104] (3 families)
   shares functional and structural similarities with the ATP-grasp fold and protein kinase superfamilies

5. Family d.143.1.1: SAICAR synthase [56105] (1 protein)

6. Protein SAICAR synthase [56106] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56107] (3 PDB entries)

8. Domain d1obga_: 1obg A: [86772]

Details for d1obga_

PDB Entry: 1obg, 2.05 Å

PDB Description: saicar-synthase complexed with atp

SCOP Domain Sequences for d1obga_:

Sequence; same for both SEQRES and ATOM records:

>d1obga_ d.143.1.1 (A:) SAICAR synthase {Baker's yeast (Saccharomyces cerevisiae)}
sitkteldgilplvargkvrdiyevdagtllfvatdrisaydvimensipekgilltkls
efwfkflsndvrnhlvdiapgktifdylpaklsepkyktqledrsllvhkhklipleviv
rgyitgsawkeyvktgtvhglkqpqglkesqefpepiftpstkaeqgehdenispaqaae
lvgedlsrrvaelavklyskckdyakekgiiiadtkfefgidektneiilvdevltpdss
rfwngasykvgesqdsydkqflrdwltanklngvngvkmpqdivdrtrakyieayetltg
skwsh

Timeline for d1obga_:

• d1obga_ first appeared in SCOP 1.65
  
• d1obga_ appears in SCOP 1.67
  
• d1obga_ appears in SCOP 1.71
  
• d1obga_ appears in the current release, SCOPe 2.08