Lineage for d1obfp2 (1obf P:153-314)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1915719Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1915720Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1915721Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 1915812Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
  7. 1915813Species Achromobacter xylosoxidans [TaxId:85698] [89987] (1 PDB entry)
    formerly Alcaligenes xylosoxidans
  8. 1915815Domain d1obfp2: 1obf P:153-314 [86771]
    Other proteins in same PDB: d1obfo1, d1obfp1
    complexed with k, pg4, so4

Details for d1obfp2

PDB Entry: 1obf (more details), 1.7 Å

PDB Description: The crystal structure of Glyceraldehyde 3-phosphate Dehydrogenase from Alcaligenes xylosoxidans at 1.7A resolution.
PDB Compounds: (P:) glyceraldehyde 3-phosphate dehydrogenase

SCOPe Domain Sequences for d1obfp2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1obfp2 d.81.1.1 (P:153-314) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]}
scttnclaplvkplndklglqdglmttvhaytnnqvltdvyhedlrrarsatmsmiptkt
gaaaavgdvlpeldgklngyairvptinvsivdlsfvakrnttveevngilkaasegelk
gildynteplvsvdynhdpasstvdasltkvsgrlvkvsswy

SCOPe Domain Coordinates for d1obfp2:

Click to download the PDB-style file with coordinates for d1obfp2.
(The format of our PDB-style files is described here.)

Timeline for d1obfp2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1obfp1