Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species) |
Species Achromobacter xylosoxidans [TaxId:85698] [89526] (1 PDB entry) formerly Alcaligenes xylosoxidans |
Domain d1obfp1: 1obf P:1-152,P:315-335 [86770] Other proteins in same PDB: d1obfo2, d1obfp2 complexed with k, pg4, so4 |
PDB Entry: 1obf (more details), 1.7 Å
SCOPe Domain Sequences for d1obfp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1obfp1 c.2.1.3 (P:1-152,P:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} tirvaingygrigrnilrahyeggkshdieivaindlgdpktnahltrydtahgkfpgtv svngsymvvngdkirvdanrnpaqlpwgalkvdvvlectgffttkekagahikggakkvi isapggadvdatvvygvnhgtlkstdtvisnaXdnewgfsnrmldttvalmsaa
Timeline for d1obfp1: