Lineage for d1obfp1 (1obf P:1-152,P:315-335)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1828622Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1828863Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)
  7. 1828864Species Achromobacter xylosoxidans [TaxId:85698] [89526] (1 PDB entry)
    formerly Alcaligenes xylosoxidans
  8. 1828866Domain d1obfp1: 1obf P:1-152,P:315-335 [86770]
    Other proteins in same PDB: d1obfo2, d1obfp2
    complexed with k, pg4, so4

Details for d1obfp1

PDB Entry: 1obf (more details), 1.7 Å

PDB Description: The crystal structure of Glyceraldehyde 3-phosphate Dehydrogenase from Alcaligenes xylosoxidans at 1.7A resolution.
PDB Compounds: (P:) glyceraldehyde 3-phosphate dehydrogenase

SCOPe Domain Sequences for d1obfp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1obfp1 c.2.1.3 (P:1-152,P:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]}
tirvaingygrigrnilrahyeggkshdieivaindlgdpktnahltrydtahgkfpgtv
svngsymvvngdkirvdanrnpaqlpwgalkvdvvlectgffttkekagahikggakkvi
isapggadvdatvvygvnhgtlkstdtvisnaXdnewgfsnrmldttvalmsaa

SCOPe Domain Coordinates for d1obfp1:

Click to download the PDB-style file with coordinates for d1obfp1.
(The format of our PDB-style files is described here.)

Timeline for d1obfp1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1obfp2