SCOP 1.67: Domain d1obfo1: 1obf O:1-152,O:315-335

Lineage for d1obfo1 (1obf O:1-152,O:315-335)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (14 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (16 species)

7. Species Achromobacter xylosoxidans [TaxId:85698] [89526] (1 PDB entry)
   formerly Alcaligenes xylosoxidans

8. Domain d1obfo1: 1obf O:1-152,O:315-335 [86768]
   Other proteins in same PDB: d1obfo2, d1obfp2

Details for d1obfo1

PDB Entry: 1obf, 1.7 Å

PDB Description: The crystal structure of Glyceraldehyde 3-phosphate Dehydrogenase from Alcaligenes xylosoxidans at 1.7A resolution.

SCOP Domain Sequences for d1obfo1:

Sequence; same for both SEQRES and ATOM records:

>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans}
tirvaingygrigrnilrahyeggkshdieivaindlgdpktnahltrydtahgkfpgtv
svngsymvvngdkirvdanrnpaqlpwgalkvdvvlectgffttkekagahikggakkvi
isapggadvdatvvygvnhgtlkstdtvisnaXdnewgfsnrmldttvalmsaa

Timeline for d1obfo1:

• d1obfo1 first appeared in SCOP 1.65
  
• d1obfo1 appears in SCOP 1.69
  
• d1obfo1 appears in the current release, SCOPe 2.08