Lineage for d1obda_ (1obd A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734637Fold d.143: SAICAR synthase-like [56103] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 734638Superfamily d.143.1: SAICAR synthase-like [56104] (3 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and protein kinase superfamilies
  5. 734639Family d.143.1.1: SAICAR synthase [56105] (1 protein)
  6. 734640Protein SAICAR synthase [56106] (2 species)
  7. 734641Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56107] (6 PDB entries)
  8. 734644Domain d1obda_: 1obd A: [86767]
    complexed with ace, amp, atp, mg, so4

Details for d1obda_

PDB Entry: 1obd (more details), 1.4 Å

PDB Description: saicar-synthase complexed with atp
PDB Compounds: (A:) phosphoribosylamidoimidazole-succinocarboxamide synthase

SCOP Domain Sequences for d1obda_:

Sequence, based on SEQRES records: (download)

>d1obda_ d.143.1.1 (A:) SAICAR synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sitkteldgilplvargkvrdiyevdagtllfvatdrisaydvimensipekgilltkls
efwfkflsndvrnhlvdiapgktifdylpaklsepkyktqledrsllvhkhklipleviv
rgyitgsawkeyvktgtvhglkqpqglkesqefpepiftpstkaeqgehdenispaqaae
lvgedlsrrvaelavklyskckdyakekgiiiadtkfefgidektneiilvdevltpdss
rfwngasykvgesqdsydkqflrdwltanklngvngvkmpqdivdrtrakyieayetltg
skw

Sequence, based on observed residues (ATOM records): (download)

>d1obda_ d.143.1.1 (A:) SAICAR synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sitkteldgilplvargkvrdiyevdagtllfvatdrisaydvimensipekgilltkls
efwfkflsndvrnhlvdiapgktifdylpaklsepkyktqledrsllvhkhklipleviv
rgyitgsawkeyvktgtvhglkqpqglkesqefpepiftpstkadenispaqaaelvged
lsrrvaelavklyskckdyakekgiiiadtkfefgidektneiilvdevltpdssrfwng
asykvgesqdsydkqflrdwltanklngvngvkmpqdivdrtrakyieayetltgskw

SCOP Domain Coordinates for d1obda_:

Click to download the PDB-style file with coordinates for d1obda_.
(The format of our PDB-style files is described here.)

Timeline for d1obda_: