SCOPe 2.03: Domain d1obca2: 1obc A:226-417

Lineage for d1obca2 (1obc A:226-417)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily)
   core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel

4. Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family)

5. Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (4 proteins)
   inserted into the catalytic domain

6. Protein Leucyl-tRNA synthetase (LeuRS) [82133] (1 species)
   in the prokaryotic and mitochondrial LeuRS this domain is inserted into a different sequential position

7. Species Thermus thermophilus [TaxId:274] [82134] (3 PDB entries)

8. Domain d1obca2: 1obc A:226-417 [86765]
   Other proteins in same PDB: d1obca1, d1obca3
   protein/RNA complex; complexed with 2ad, leu, lms, nva, zn

Details for d1obca2

PDB Entry: 1obc, 2.1 Å

PDB Description: leucyl-trna synthetase from thermus thermophilus complexed with a post-transfer editing substrate analogue

PDB Compounds: (A:) leucyl-tRNA synthetase

SCOPe Domain Sequences for d1obca2:

Sequence; same for both SEQRES and ATOM records:

>d1obca2 b.51.1.1 (A:226-417) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus [TaxId: 274]}
rsegaeilfpvegkevripvfttrpdtlfgatflvlapehpltlelaapekreevlayve
aakrkteierqaegrektgvflgayalnpatgeripiwtadyvlfgygtgaimavpahdq
rdyefarkfglpikkvierpgeplpeplerayeepgimvnsgpfdgteseegkrkviawl
eekglgkgrvty

Timeline for d1obca2:

• d1obca2 first appeared in SCOP 1.65
  
• d1obca2 appears in SCOPe 2.02
  
• d1obca2 appears in SCOPe 2.04
  
• d1obca2 appears in the current release, SCOPe 2.08