Lineage for d1obca2 (1obc A:226-417)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 300412Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily)
    core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel
  4. 300413Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family) (S)
  5. 300414Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (3 proteins)
    inserted into the catalytic domain
  6. 300424Protein Leucyl-tRNA synthetase (LeuRS) [82133] (1 species)
    in the prokaryotic and mitochondrial LeuRS this domain is inserted into a different sequential position
  7. 300425Species Thermus thermophilus [TaxId:274] [82134] (3 PDB entries)
  8. 300427Domain d1obca2: 1obc A:226-417 [86765]
    Other proteins in same PDB: d1obca1, d1obca3
    complexed with 2ad, leu, lms, nva, zn

Details for d1obca2

PDB Entry: 1obc (more details), 2.1 Å

PDB Description: leucyl-trna synthetase from thermus thermophilus complexed with a post-transfer editing substrate analogue

SCOP Domain Sequences for d1obca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1obca2 b.51.1.1 (A:226-417) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus}
rsegaeilfpvegkevripvfttrpdtlfgatflvlapehpltlelaapekreevlayve
aakrkteierqaegrektgvflgayalnpatgeripiwtadyvlfgygtgaimavpahdq
rdyefarkfglpikkvierpgeplpeplerayeepgimvnsgpfdgteseegkrkviawl
eekglgkgrvty

SCOP Domain Coordinates for d1obca2:

Click to download the PDB-style file with coordinates for d1obca2.
(The format of our PDB-style files is described here.)

Timeline for d1obca2: