Class a: All alpha proteins [46456] (202 folds) |
Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (1 family) |
Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins) |
Protein Leucyl-tRNA synthetase (LeuRS) [81746] (1 species) |
Species Thermus thermophilus [TaxId:274] [81747] (3 PDB entries) |
Domain d1obca1: 1obc A:687-814 [86764] Other proteins in same PDB: d1obca2, d1obca3 The C-terminal region (residues 815-878) is invisible in the electron density complexed with 2ad, leu, lms, nva, zn |
PDB Entry: 1obc (more details), 2.1 Å
SCOP Domain Sequences for d1obca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1obca1 a.27.1.1 (A:687-814) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus} flnriyrrvaedrealletsgvfqaealegkdrelygklhetlkkvtedlealrfntaia almeflnalyeyrkdrpvtpvyrtairyylqmlfpfaphlaeelwhwfwpdslfeagwpe ldekalek
Timeline for d1obca1: