![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
![]() | Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) ![]() |
![]() | Family d.162.1.2: AglA-like glucosidase [90050] (4 proteins) family 4 glycosyl hydrolase |
![]() | Protein Alpha-glucosidase AglA [90051] (1 species) |
![]() | Species Thermotoga maritima [TaxId:243274] [90052] (1 PDB entry) TM1834 |
![]() | Domain d1obba2: 1obb A:173-480 [86761] Other proteins in same PDB: d1obba1, d1obbb1 |
PDB Entry: 1obb (more details), 1.9 Å
SCOP Domain Sequences for d1obba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1obba2 d.162.1.2 (A:173-480) Alpha-glucosidase AglA {Thermotoga maritima} fchghygvmeiveklgleeekvdwqvagvnhgiwlnrfrynggnayplldkwieekskdw kpenpfndqlspaaidmyrfygvmpigdtvrnsswryhrdletkkkwygepwggadseig wkwyqdtlgkvteitkkvakfikenpsvrlsdlgsvlgkdlsekqfvlevekildperks geqhipfidallndnkarfvvnipnkgiihgidddvvvevpalvdkngihpekiepplpd rvvkyylrprimrmemaleafltgdiriikellyrdprtksdeqvekvieeilalpenee mrkhylkr
Timeline for d1obba2: