SCOP 1.67: Domain d1obba2: 1obb A:173-480

Lineage for d1obba2 (1obb A:173-480)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families)

5. Family d.162.1.2: AglA-like glucosidase [90050] (3 proteins)
   family 4 glycosyl hydrolase

6. Protein Alpha-glucosidase AglA [90051] (1 species)

7. Species Thermotoga maritima [TaxId:243274] [90052] (1 PDB entry)
   TM1834

8. Domain d1obba2: 1obb A:173-480 [86761]
   Other proteins in same PDB: d1obba1, d1obbb1

Details for d1obba2

PDB Entry: 1obb, 1.9 Å

PDB Description: alpha-glucosidase a, agla, from thermotoga maritima in complex with maltose and nad+

SCOP Domain Sequences for d1obba2:

Sequence; same for both SEQRES and ATOM records:

>d1obba2 d.162.1.2 (A:173-480) Alpha-glucosidase AglA {Thermotoga maritima}
fchghygvmeiveklgleeekvdwqvagvnhgiwlnrfrynggnayplldkwieekskdw
kpenpfndqlspaaidmyrfygvmpigdtvrnsswryhrdletkkkwygepwggadseig
wkwyqdtlgkvteitkkvakfikenpsvrlsdlgsvlgkdlsekqfvlevekildperks
geqhipfidallndnkarfvvnipnkgiihgidddvvvevpalvdkngihpekiepplpd
rvvkyylrprimrmemaleafltgdiriikellyrdprtksdeqvekvieeilalpenee
mrkhylkr

Timeline for d1obba2:

• d1obba2 first appeared in SCOP 1.65
  
• d1obba2 appears in SCOP 1.69
  
• d1obba2 appears in the current release, SCOPe 2.08