Lineage for d1obba2 (1obb A:173-480)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2999460Family d.162.1.2: AglA-like glucosidase [90050] (5 proteins)
    family 4 glycosyl hydrolase
    automatically mapped to Pfam PF11975
  6. 2999489Protein Alpha-glucosidase AglA [90051] (1 species)
  7. 2999490Species Thermotoga maritima [TaxId:2336] [90052] (1 PDB entry)
    TM1834
  8. 2999491Domain d1obba2: 1obb A:173-480 [86761]
    Other proteins in same PDB: d1obba1, d1obbb1
    complexed with nad

Details for d1obba2

PDB Entry: 1obb (more details), 1.9 Å

PDB Description: alpha-glucosidase a, agla, from thermotoga maritima in complex with maltose and nad+
PDB Compounds: (A:) alpha-glucosidase

SCOPe Domain Sequences for d1obba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1obba2 d.162.1.2 (A:173-480) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]}
fchghygvmeiveklgleeekvdwqvagvnhgiwlnrfrynggnayplldkwieekskdw
kpenpfndqlspaaidmyrfygvmpigdtvrnsswryhrdletkkkwygepwggadseig
wkwyqdtlgkvteitkkvakfikenpsvrlsdlgsvlgkdlsekqfvlevekildperks
geqhipfidallndnkarfvvnipnkgiihgidddvvvevpalvdkngihpekiepplpd
rvvkyylrprimrmemaleafltgdiriikellyrdprtksdeqvekvieeilalpenee
mrkhylkr

SCOPe Domain Coordinates for d1obba2:

Click to download the PDB-style file with coordinates for d1obba2.
(The format of our PDB-style files is described here.)

Timeline for d1obba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1obba1