SCOPe 2.07: Domain d1obba1: 1obb A:2-172

Lineage for d1obba1 (1obb A:2-172)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Alpha-glucosidase AglA [89530] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [89531] (1 PDB entry)
   TM1834

8. Domain d1obba1: 1obb A:2-172 [86760]
   Other proteins in same PDB: d1obba2, d1obbb2
   complexed with mal, nad

Details for d1obba1

PDB Entry: 1obb, 1.9 Å

PDB Description: alpha-glucosidase a, agla, from thermotoga maritima in complex with maltose and nad+

PDB Compounds: (A:) alpha-glucosidase

SCOPe Domain Sequences for d1obba1:

Sequence; same for both SEQRES and ATOM records:

>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]}
psvkigiigagsavfslrlvsdlcktpglsgstvtlmdideerldailtiakkyveevga
dlkfektmnlddviidadfvintamvgghtylekvrqigekygyyrgidaqefnmvsdyy
tfsnynqlkyfvdiarkieklspkawylqaanpifegttlvtrtvpikavg

Timeline for d1obba1:

• d1obba1 first appeared in SCOP 1.65
  
• d1obba1 appears in SCOPe 2.06
  
• d1obba1 appears in the current release, SCOPe 2.08