![]() | Class g: Small proteins [56992] (66 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (18 superfamilies) disulphide-bound fold; contains beta-hairpin with two adjacent disulphides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (6 families) ![]() |
![]() | Family g.3.11.4: Merozoite surface protein 1 (MSP-1) [57239] (1 protein) |
![]() | Protein Merozoite surface protein 1 (MSP-1) [57240] (3 species) |
![]() | Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [57242] (2 PDB entries) |
![]() | Domain d1ob1f1: 1ob1 F:1-45 [86758] Other proteins in same PDB: d1ob1a1, d1ob1a2, d1ob1b1, d1ob1b2, d1ob1d1, d1ob1d2, d1ob1e1, d1ob1e2 |
PDB Entry: 1ob1 (more details), 2.9 Å
SCOP Domain Sequences for d1ob1f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ob1f1 g.3.11.4 (F:1-45) Merozoite surface protein 1 (MSP-1) {Malaria parasite (Plasmodium falciparum)} nisqhqcvkkqcpqnsgcfrhldereeckcllnykqegdkcvenp
Timeline for d1ob1f1: