SCOPe 2.07: Domain d1ob1d1: 1ob1 D:1-106A

Lineage for d1ob1d1 (1ob1 D:1-106A)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88527] (13 PDB entries)

8. Domain d1ob1d1: 1ob1 D:1-106A [86754]
   Other proteins in same PDB: d1ob1a2, d1ob1b1, d1ob1b2, d1ob1c1, d1ob1c2, d1ob1c3, d1ob1d2, d1ob1e1, d1ob1e2, d1ob1f1, d1ob1f2, d1ob1f3
   part of anti-Pf MSP1 Fab
   complexed with cac

Details for d1ob1d1

PDB Entry: 1ob1, 2.9 Å

PDB Description: crystal structure of a fab complex whith plasmodium falciparum msp1-19

PDB Compounds: (D:) antibody, heavy chain

SCOPe Domain Sequences for d1ob1d1:

Sequence; same for both SEQRES and ATOM records:

>d1ob1d1 b.1.1.1 (D:1-106A) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
divmtqtpaimsaflgervtmtctatsslsssylhwyqqkpgsspklwiyttsnlasgvp
srfsgsgsgtsysltissmeaedaatyychqfhhspytfgggtkleik

Timeline for d1ob1d1:

• d1ob1d1 first appeared in SCOP 1.65
  
• d1ob1d1 appears in SCOPe 2.06
  
• d1ob1d1 appears in the current release, SCOPe 2.08