Lineage for d1ob1a1 (1ob1 A:1-106A)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2741196Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88527] (13 PDB entries)
  8. 2741209Domain d1ob1a1: 1ob1 A:1-106A [86748]
    Other proteins in same PDB: d1ob1a2, d1ob1b1, d1ob1b2, d1ob1c1, d1ob1c2, d1ob1c3, d1ob1d2, d1ob1e1, d1ob1e2, d1ob1f1, d1ob1f2, d1ob1f3
    part of anti-Pf MSP1 Fab
    complexed with cac

Details for d1ob1a1

PDB Entry: 1ob1 (more details), 2.9 Å

PDB Description: crystal structure of a fab complex whith plasmodium falciparum msp1-19
PDB Compounds: (A:) antibody, heavy chain

SCOPe Domain Sequences for d1ob1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ob1a1 b.1.1.1 (A:1-106A) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
divmtqtpaimsaflgervtmtctatsslsssylhwyqqkpgsspklwiyttsnlasgvp
srfsgsgsgtsysltissmeaedaatyychqfhhspytfgggtkleik

SCOPe Domain Coordinates for d1ob1a1:

Click to download the PDB-style file with coordinates for d1ob1a1.
(The format of our PDB-style files is described here.)

Timeline for d1ob1a1: