SCOP 1.73: Domain d1oanb2: 1oan B:1-297

Lineage for d1oanb2 (1oan B:1-297)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
   2 intertwined domains; all-beta and alpha+beta

4. Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (1 family)

5. Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (2 proteins)

6. Protein Envelope glycoprotein [56985] (2 species)

7. Species Dengue virus type 2 [TaxId:11060] [90131] (7 PDB entries)

8. Domain d1oanb2: 1oan B:1-297 [86743]
   Other proteins in same PDB: d1oana1, d1oanb1
   complexed with afl, bma, na, nag

Details for d1oanb2

PDB Entry: 1oan, 2.75 Å

PDB Description: crystal structure of the dengue 2 virus envelope protein

PDB Compounds: (B:) Envelope glycoprotein

SCOP Domain Sequences for d1oanb2:

Sequence; same for both SEQRES and ATOM records:

>d1oanb2 f.10.1.1 (B:1-297) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]}
mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
ieakltntttesrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamft
ckknmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygt
vtmecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf
knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm

Timeline for d1oanb2:

• d1oanb2 first appeared in SCOP 1.65
  
• d1oanb2 appears in SCOP 1.71
  
• d1oanb2 appears in SCOP 1.75
  
• d1oanb2 appears in the current release, SCOPe 2.08