Lineage for d1oaja_ (1oaj A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 291100Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) (S)
    has additional strand at N-terminus
  5. 291101Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 protein domains)
  6. 291114Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)
  7. 291258Species Photobacterium leiognathi [49337] (9 PDB entries)
  8. 291260Domain d1oaja_: 1oaj A: [86738]
    complexed with cu, zn; mutant

Details for d1oaja_

PDB Entry: 1oaj (more details), 1.73 Å

PDB Description: active site copper and zinc ions modulate the quaternary structure of prokaryotic cu,zn superoxide dismutase

SCOP Domain Sequences for d1oaja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oaja_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Photobacterium leiognathi}
qdltvkmtdlqtgkpvgtielsqndygvvfipeladltpgmhgfhihqngscassekdgk
vvlggaagghydpehtnkhgfpwtddnhkgdlpalfvsanglatnpvlaprltlkelkgh
aimihaggdnhsdmpkalggggarvacgviq

SCOP Domain Coordinates for d1oaja_:

Click to download the PDB-style file with coordinates for d1oaja_.
(The format of our PDB-style files is described here.)

Timeline for d1oaja_: